PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000707-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 411aa    MW: 45289.5 Da    PI: 4.9315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000707-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-141478148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.................TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.................kgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v ++G+g+W++++++ g                 ++R++k+c++rw +yl
    NNU_000707-RA 14 RGLWTEEEDAKILAYVSKHGTGNWTSVPKKAGklalemadlirlnfytgLKRCGKSCRLRWTNYL 78
                     788************************************************************97 PP

2Myb_DNA-binding48.32.2e-1586127346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+el++++++  G++ W++Ia+ ++ gRt++++k++w++
    NNU_000707-RA  86 SFTPQEEELIINLHQAIGSR-WSLIAAQLP-GRTDNDVKNYWNT 127
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23581IPR009057Homeodomain-like
PROSITE profilePS5129416.068978IPR017930Myb domain
SuperFamilySSF466891.54E-2711125IPR009057Homeodomain-like
SMARTSM007172.5E-121380IPR001005SANT/Myb domain
PfamPF002491.5E-141478IPR001005SANT/Myb domain
CDDcd001672.41E-101778No hitNo description
PROSITE profilePS5129423.07879133IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-2582133IPR009057Homeodomain-like
SMARTSM007173.9E-1483131IPR001005SANT/Myb domain
CDDcd001679.90E-1186129No hitNo description
PfamPF002494.6E-1486127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTEE EDAKILAYVS KHGTGNWTSV PKKAGKLALE MADLIRLNFY  60
TGLKRCGKSC RLRWTNYLRP DLKHESFTPQ EEELIINLHQ AIGSRWSLIA AQLPGRTDND  120
VKNYWNTKLR KKLYEMGIDP VTHKPFSQIL ADYGNIGGLP RAGNRIGSLN RDLRNAFMSK  180
SESAPLPQEA ILNASSHSIM TIRTPKMEPI QDCHTNNNGS SSNNNNHCWD LLAELQAIKL  240
VTEASNSTNQ ETIPPLFFSE GSSMSSSSVS ILPVNSAPPM PCQSSPMQTM PSSPFSWSEF  300
LVEDAVLPSE QQTQCYLDFQ GLSSSTGSSS QIEMHDDITQ NGLNSEANKT FYDVGETDYG  360
GGQGFAGIDK GGANNAFGAS SSSDNSFIDA ILDQDGEMSW EFVDILSEPF Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141337108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264963.10.0PREDICTED: transcription factor MYB76
TrEMBLA0A0D2UC281e-126A0A0D2UC28_G
STRINGPOPTR_0015s07900.11e-124(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-74MYB family protein